SLFN12 Antibody - middle region : Biotin

SLFN12 Antibody - middle region : Biotin
Artikelnummer
AVIARP57096_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLFN12

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Schlafen family member 12

Protein Size: 578

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57096_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57096_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55106
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×