SLFN12 Antibody - N-terminal region : HRP

SLFN12 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57095_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLFN12

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Schlafen family member 12

Protein Size: 578

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57095_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57095_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55106
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×