SMAP1 Antibody - N-terminal region : HRP

SMAP1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56281_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: stromal membrane-associated protein 1

Protein Size: 467

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56281_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56281_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 684800
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×