Smarcd3 Antibody - C-terminal region : FITC

Smarcd3 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58323_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Smarcd3 plays a role in ATP dependent nucleosome remodeling by SMARCA4 containing complexes. It stimulates nuclear receptor mediated transcription. It belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3

Protein Size: 483

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58323_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58323_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 66993
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×