SMG5 Antibody - N-terminal region : FITC

SMG5 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55229_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMG5

Key Reference: Glavan,F., (2006) EMBO J. 25 (21), 5117-5125

Molecular Weight: 114kDa

Peptide Sequence: Synthetic peptide located within the following region: MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SMG5

Protein Size: 1016

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55229_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55229_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23381
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×