SNF8 Antibody - middle region : FITC

SNF8 Antibody - middle region : FITC
Artikelnummer
AVIARP57950_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNF8

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar-sorting protein SNF8

Protein Size: 258

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57950_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57950_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11267
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×