SNRK Antibody - middle region : Biotin

SNRK Antibody - middle region : Biotin
Artikelnummer
AVIARP56306_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNRK

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SNF-related serine/threonine-protein kinase

Protein Size: 765

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56306_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56306_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54861
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×