SNTG1 Antibody - middle region : FITC

SNTG1 Antibody - middle region : FITC
Artikelnummer
AVIARP57300_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal doma

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNTG1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-1-syntrophin

Protein Size: 517

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57300_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57300_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54212
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×