SNX5 Antibody - N-terminal region : FITC

SNX5 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55050_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown. This gene results in two transcript variants encoding the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNX5

Key Reference: Wassmer,T., J. Cell. Sci. 120 (PT 1), 45-54 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-5

Protein Size: 404

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55050_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55050_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27131
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×