SNX7 Antibody - middle region : HRP

SNX7 Antibody - middle region : HRP
Artikelnummer
AVIARP56795_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like s

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNX7

Key Reference: Dateki,M., (2005) J. Biol. Chem. 280 (21), 20503-20508

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sorting nexin-7

Protein Size: 387

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56795_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56795_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51375
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×