SOCS7 Antibody - N-terminal region : Biotin

SOCS7 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP53701_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. It functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. It inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOCS7

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Suppressor of cytokine signaling 7

Protein Size: 331

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53701_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53701_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 30837
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×