SOCS7 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOCS7

Key Reference: Kremer,B.E., (2007) Cell 130 (5), 837-850

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Suppressor of cytokine signaling 7

Protein Size: 581

Purification: Affinity Purified

• Artikelnummer: AVIARP53700_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53700_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 30837
• Wirt: Rabbit
• Konjugat: Conjugated, FITC