SOCS7 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. It functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. It inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOCS7

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Suppressor of cytokine signaling 7

Protein Size: 331

Purification: Affinity Purified

• Artikelnummer: AVIARP53701_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53701_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 30837
• Wirt: Rabbit
• Konjugat: Conjugated, HRP