SOHLH1 Antibody - C-terminal region : FITC

SOHLH1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54547_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SOHLH1

Key Reference: Pangas,S.A., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (21), 8090-8095

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1

Protein Size: 387

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54547_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54547_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 402381
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×