SOX15 Antibody - N-terminal region : FITC

SOX15 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57899_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX15

Key Reference: Yan,H.T., (2007) Mol. Cells 24 (3), 323-328

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: ALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SOX-15

Protein Size: 233

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57899_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57899_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6665
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×