Spa17 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Spa17 is a component of sperm acrosome; Spa17 binds A-kinase anchoring protein 3 (Akap3) and is thought to be involved in fertilization by binding to the zona pellucida of the oocyte。

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Spa17

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: AYFENLLEKREKTSFDPAEWGAKVEDRFYNNHAFKDPEQAEKCEQEIAKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sperm surface protein Sp17 PIRNR PIRNR016533

Protein Size: 148

Purification: Affinity Purified

• Artikelnummer: AVIARP53720_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53720_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 85244
• Wirt: Rabbit
• Konjugat: Conjugated, FITC