SPACA9 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: sperm acrosome-associated protein 9

Protein Size: 168

Purification: Affinity Purified

• Artikelnummer: AVIARP53733_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53733_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 69987
• Wirt: Rabbit
• Konjugat: Conjugated, FITC