SPAG6 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPAG6

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: LQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sperm-associated antigen 6

Protein Size: 458

Purification: Affinity Purified

• Artikelnummer: AVIARP53838_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53838_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 9576
• Wirt: Rabbit
• Konjugat: Conjugated, FITC