SPATA24 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.SPATA24 may play a role in cytoplasm movement and removal during spermiogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human SPATA24

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-associated protein 24

Protein Size: 205

Purification: Affinity Purified

• Artikelnummer: AVIARP53546_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53546_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 202051
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin