Spata6 Antibody - C-terminal region : HRP

Spata6 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53737_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Spata6 may function as a molecular motor in meiosis and have a role in spermatogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Spata6

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: RVKDVLKSHQAHGRHLCEERDPEKEDELELKRSLLYRDSAYDSDPEYSSF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatogenesis-associated protein 6

Protein Size: 430

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53737_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53737_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 171413
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×