SPATA6 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPATA6

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatogenesis-associated protein 6

Protein Size: 488

Purification: Affinity Purified

• Artikelnummer: AVIARP53736_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53736_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54558
• Wirt: Rabbit
• Konjugat: Conjugated, HRP