SPDYA Antibody - middle region : FITC

SPDYA Antibody - middle region : FITC
Artikelnummer
AVIARP55846_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPDYA

Key Reference: McAndrew,C.W., (2007) Cell Cycle 6 (15), 1937-1945

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Speedy protein A

Protein Size: 313

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55846_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55846_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 245711
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×