SPINK6 Antibody - middle region : HRP

SPINK6 Antibody - middle region : HRP
Artikelnummer
AVIARP55978_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPINK6

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine protease inhibitor Kazal-type 6

Protein Size: 80

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55978_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55978_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 404203
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×