SPNS2 Antibody - N-terminal region : FITC

SPNS2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56057_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPNS2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein spinster homolog 2

Protein Size: 549

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56057_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56057_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 124976
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×