SPNS2 Antibody - N-terminal region : HRP

SPNS2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56057_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPNS2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein spinster homolog 2

Protein Size: 549

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56057_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56057_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 124976
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×