SQSTM1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to m

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SQSTM1

Key Reference: Soma,H., (er) Mov. Disord. (2008) In press

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sequestosome-1

Protein Size: 440

Purification: Affinity Purified

• Artikelnummer: AVIARP54262_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54262_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 8878
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin