SRR Antibody - middle region : FITC

SRR Antibody - middle region : FITC
Artikelnummer
AVIARP57572_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SRR catalyzes the synthesis of D-serine from L-serine.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRR

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine racemase

Protein Size: 340

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57572_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57572_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63826
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×