SRR Antibody - middle region : HRP

SRR Antibody - middle region : HRP
Artikelnummer
AVIARP57572_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SRR catalyzes the synthesis of D-serine from L-serine.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRR

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine racemase

Protein Size: 340

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57572_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57572_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63826
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×