SS18L1 Antibody - middle region : Biotin

SS18L1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55923_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific functin of this protein remains unknown.Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L1 gene is homologous to SS18.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SS18L1

Key Reference: de Cytogenet. Genome Res. 112 (3-4), 222-226 (2006)

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-responsive transactivator

Protein Size: 396

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55923_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55923_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26039
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×