SSBP3 Antibody - middle region : FITC

SSBP3 Antibody - middle region : FITC
Artikelnummer
AVIARP55355_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSBP3

Key Reference: Adams,M.D., (2006) Biochem. Biophys. Res. Commun. 339 (3), 977-984

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Single-stranded DNA-binding protein 3

Protein Size: 368

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55355_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55355_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23648
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×