SSX2IP Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSX2IP

Key Reference: Guinn,B.A., (2008) Br. J. Haematol. 140 (2), 250-251

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Afadin- and alpha-actinin-binding protein

Protein Size: 614

Purification: Affinity Purified

• Artikelnummer: AVIARP53690_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53690_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 117178
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin