ST6GALNAC2 Antibody - middle region : Biotin

ST6GALNAC2 Antibody - middle region : Biotin
Artikelnummer
AVIARP53653_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting.ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-255 AC015802.21 33337-33591 256-1378 BT019972.1 1-1123 1379-2105 AC015802.21 53295-54021

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ST6GALNAC2

Key Reference: Li,G.S., (2007) Hum. Mutat. 28 (10), 950-957

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2

Protein Size: 374

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53653_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53653_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10610
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×