STAG3 Antibody - middle region : FITC

STAG3 Antibody - middle region : FITC
Artikelnummer
AVIARP53683_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human STAG3

Key Reference: Barber,T.D., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3443-3448

Molecular Weight: 135kDa

Peptide Sequence: Synthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cohesin subunit SA-3

Protein Size: 1225

Purification: Affinity Purified

Subunit: SA-3
Mehr Informationen
Artikelnummer AVIARP53683_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53683_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10734
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×