STAMBP Antibody - C-terminal region : FITC

STAMBP Antibody - C-terminal region : FITC
Artikelnummer
AVIARP53527_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.STAMBPL1 does not cleave 'Lys-48'-linked polyubiquitin chains.

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: STAM-binding protein

Protein Size: 424

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53527_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53527_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10617
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×