STAMBP Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAMBP

Key Reference: Row,P.E., (2007) J. Biol. Chem. 282 (42), 30929-30937

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: STAM-binding protein

Protein Size: 424

Purification: Affinity Purified

• Artikelnummer: AVIARP53526_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53526_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10617
• Wirt: Rabbit
• Konjugat: Conjugated, FITC