STAMBPL1 Antibody - N-terminal region : FITC

STAMBPL1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57453_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.STAMBPL1 does not cleave 'Lys-48'-linked polyubiquitin chains.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAMBPL1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AMSH-like protease

Protein Size: 436

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57453_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57453_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57559
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×