STIMATE Antibody - N-terminal region : Biotin

STIMATE Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55905_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM110

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: store-operated calcium entry regulator STIMATE

Protein Size: 294

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55905_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55905_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 375346
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×