STK32A Antibody - N-terminal region : Biotin

STK32A Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55655_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human STK32A

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: PVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase 32C

Protein Size: 358

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55655_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55655_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 202374
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×