STK38L Antibody - middle region : FITC

STK38L Antibody - middle region : FITC
Artikelnummer
AVIARP55142_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human STK38L

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase 38-like

Protein Size: 464

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55142_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55142_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23012
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×