STK38L Antibody - middle region : HRP

STK38L Antibody - middle region : HRP
Artikelnummer
AVIARP55142_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human STK38L

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase 38-like

Protein Size: 464

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55142_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55142_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23012
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×