Stxbp6 Antibody - N-terminal region : FITC

Stxbp6 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54989_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Stxbp6 forms non-fusogenic complexes with SNAP25 and STX1A and may thereby modulate the formation of functional SNARE complexes and exocytosis.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SAISKEIFAPLDERMLGAIQVKRRTKKKIPFLATGGQGEYLTYICLSVTN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Syntaxin-binding protein 6

Protein Size: 210

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54989_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54989_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 217517
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×