Stxbp6 Antibody - N-terminal region : HRP

Stxbp6 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54989_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Stxbp6 forms non-fusogenic complexes with SNAP25 and STX1A and may thereby modulate the formation of functional SNARE complexes and exocytosis.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SAISKEIFAPLDERMLGAIQVKRRTKKKIPFLATGGQGEYLTYICLSVTN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Syntaxin-binding protein 6

Protein Size: 210

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54989_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54989_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 217517
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×