SUSD3 Antibody - N-terminal region : Biotin

SUSD3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55443_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of SUSD3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUSD3

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sushi domain-containing protein 3

Protein Size: 255

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55443_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55443_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 203328
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×