SUSD3 Antibody - N-terminal region : HRP

SUSD3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55443_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of SUSD3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUSD3

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sushi domain-containing protein 3

Protein Size: 255

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55443_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55443_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 203328
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×