SYCP3 Antibody - N-terminal region : Biotin

SYCP3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58334_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SYCP3 is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It has an essential meiotic function in spermatogenesis. SYCP3 may be important for testis development.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYCP3

Key Reference: Bukovsky,A., (2008) Cell Cycle 7 (5), 683-686

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synaptonemal complex protein 3

Protein Size: 236

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58334_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58334_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 50511
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×