TAF1C Antibody - N-terminal region : FITC

TAF1C Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57920_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1C is the largest SL1-specific TAF. Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1C

Key Reference: Friedrich,J.K., (2005) J. Biol. Chem. 280 (33), 29551-29558

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TATA box-binding protein-associated factor RNA polymerase I subunit C

Protein Size: 869

Purification: Affinity Purified

Subunit: C
Mehr Informationen
Artikelnummer AVIARP57920_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57920_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9013
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×