TAF1C Antibody - N-terminal region : HRP

TAF1C Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57920_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1C is the largest SL1-specific TAF. Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1C

Key Reference: Friedrich,J.K., (2005) J. Biol. Chem. 280 (33), 29551-29558

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TATA box-binding protein-associated factor RNA polymerase I subunit C

Protein Size: 869

Purification: Affinity Purified

Subunit: C
Mehr Informationen
Artikelnummer AVIARP57920_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57920_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9013
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×