TAF7L Antibody - C-terminal region : Biotin

TAF7L Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP53779_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. The encoded protein could be a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: QIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription initiation factor TFIID subunit 7-like

Protein Size: 376

Purification: Affinity Purified

Subunit: 7-like
Mehr Informationen
Artikelnummer AVIARP53779_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53779_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54457
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×