TAF7L Antibody - middle region : FITC

TAF7L Antibody - middle region : FITC
Artikelnummer
AVIARP53778_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAF7L

Key Reference: Akinloye,O., (2007) Andrologia 39 (5), 190-195

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription initiation factor TFIID subunit 7-like

Protein Size: 462

Purification: Affinity Purified

Subunit: 7-like
Mehr Informationen
Artikelnummer AVIARP53778_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53778_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54457
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×