TBC1D1 Antibody - middle region : HRP

TBC1D1 Antibody - middle region : HRP
Artikelnummer
AVIARP55189_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6; MIM 604334), yeast Bub2, and CDC16 (MIM 603461) (White et al., 2000 [PubMed 10965142]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-225 BC050321.1 13-237 226-950 BC050321.1 896-1620 951-1020 BC028196.1 226-295 1021-1123 BC029950.1 255-357 1124-1433 BC028196.1 399-708 1434-1608 BC029950.1 668-842 1609-4133 BC053648.1 437-2961 4134-5688 AK074954.1 1433-2987

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D1

Key Reference: Meyre,D., (er) Hum. Mol. Genet. (2008) In press

Molecular Weight: 133kDa

Peptide Sequence: Synthetic peptide located within the following region: RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 1

Protein Size: 1168

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55189_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55189_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 23216
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×